PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00875.1.g00270.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 429aa    MW: 45709 Da    PI: 6.5095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00875.1.g00270.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-18116160348
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +WT+eEd +l d v+q+G   W+ Ia++++ gR +kqc++rw ++l
  Zpz_sc00875.1.g00270.1.sm.mk 116 SWTAEEDSILRDMVEQYGETKWSVIAHHLP-GRIGKQCRERWINHL 160
                                   7*****************************.************996 PP

2Myb_DNA-binding54.72.3e-17169209345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                    WT+eEd+ l+da+k +G++ W+ Ia++++ gR+++ +k++w+
  Zpz_sc00875.1.g00270.1.sm.mk 169 VWTEEEDKMLIDAHKYHGNH-WAIIAKYLP-GRSENAVKNHWN 209
                                   7*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.428109164IPR017930Myb domain
SuperFamilySSF466892.87E-31113208IPR009057Homeodomain-like
SMARTSM007173.5E-17113162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-23114162IPR009057Homeodomain-like
PfamPF002493.5E-16115160IPR001005SANT/Myb domain
CDDcd001678.02E-17116160No hitNo description
Gene3DG3DSA:1.10.10.601.5E-19163213IPR009057Homeodomain-like
PROSITE profilePS5129418.956165216IPR017930Myb domain
SMARTSM007177.1E-15166214IPR001005SANT/Myb domain
PfamPF002499.2E-16169209IPR001005SANT/Myb domain
CDDcd001671.67E-13170212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MAARNSVPVD EEQAPPVLAG WIYLGSSYHG GAHFQNGLVP AFVHAGADRS TGVPVDMSSL  60
VASIGLAPVG FEMPEGGLAA TSFGASDVVP APPQGAMNLQ PQIGSDNKPP GPLKASWTAE  120
EDSILRDMVE QYGETKWSVI AHHLPGRIGK QCRERWINHL HPDIKQNDVW TEEEDKMLID  180
AHKYHGNHWA IIAKYLPGRS ENAVKNHWNA TLRSLKAKRP MKKKKSEQVP KGQFSILEEY  240
IRSQHPEDAS IRAAPAPPSP APPHHLAYGS GLPPPAADAP AAFPNNTGMS FHGDNSAPGS  300
SNRGMINLNM PPMLPDLNTI SEPQDYQLNY ATVYVPVPPA PATQLQLAPA QDSLQVSSSL  360
NLSPYADYFA FLGGDPGRHH HAGVSSGNPG GSGYYNEAGQ GRAGGAGGNT GDGKELASSS  420
REFSPPFSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-411132133102C-Myb DNA-Binding Domain
1msf_C5e-411132133102C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-111PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS581e-111K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-43myb domain protein 98